missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMMPRIN/CD147 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£240.00 - £409.00
Specifications
| Antigen | EMMPRIN/CD147 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18258022
|
Novus Biologicals
NBP2-57810 |
100 μL |
£409.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18679078
|
Novus Biologicals
NBP2-57810-25ul |
25 μL |
£240.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EMMPRIN/CD147 Polyclonal specifically detects EMMPRIN/CD147 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| EMMPRIN/CD147 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Signal Transduction, Vision | |
| 5F7, basigin, basigin (Ok blood group), CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRINTCSF, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M6, OK, OK blood group antigen, Tumor cell-derived collagenase stimulatory factor | |
| BSG | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 682 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title