EMMPRIN/CD147 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57810

Product Code. 18258022

Description

EMMPRIN/CD147 Polyclonal specifically detects EMMPRIN/CD147 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: EMMPRIN/CD147
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: 5F7, basigin, basigin (Ok blood group), CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRINTCSF, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M6, OK, OK blood group antigen, Tumor cell-derived collagenase stimulatory factor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: BSG
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGT
• Quantity: 100 μL
• Research Discipline: Cancer, Signal Transduction, Vision
• Gene ID (Entrez): 682
• Target Species: Human
• Isotype: IgG

For Research Use Only