missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | EMG1 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18223280
|
Novus Biologicals
NBP2-54688 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625536
|
Novus Biologicals
NBP2-54688-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EMG1 Polyclonal specifically detects EMG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EMG1 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1, BWCNS, C2F18S rRNA Psi1248 methyltransferase, EMG1 nucleolar protein homolog (S. cerevisiae), essential for mitotic growth 1, FLJ60792, Grcc2f, NEP1EC 2.1.1.-, Nucleolar protein EMG1 homolog, probable ribosome biogenesis protein NEP1, Protein C2f, Ribosome biogenesis protein NEP1 | |
| EMG1 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10436 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title