EMG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-54688

Product Code. 18223280

Description

EMG1 Polyclonal specifically detects EMG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EMG1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: 18S rRNA (pseudouridine-N1-)-methyltransferase NEP1, BWCNS, C2F18S rRNA Psi1248 methyltransferase, EMG1 nucleolar protein homolog (S. cerevisiae), essential for mitotic growth 1, FLJ60792, Grcc2f, NEP1EC 2.1.1.-, Nucleolar protein EMG1 homolog, probable ribosome biogenesis protein NEP1, Protein C2f, Ribosome biogenesis protein NEP1
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: EMG1
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:SDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAKLTTAFEEVW
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 10436
• Target Species: Human
• Isotype: IgG