missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EIF4A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£361.00
Specifications
| Antigen | EIF4A3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
EIF4A3 Polyclonal specifically detects EIF4A3 in Human samples. It is validated for Western Blot.Specifications
| EIF4A3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| 9775 | |
| Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| P38919 | |
| EIF4A3 | |
| IgG | |
| Protein A purified |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel