EIF4A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57342

Product Code. 18296812

Description

EIF4A3 Polyclonal specifically detects EIF4A3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EIF4A3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Yellowfever mosquito: 100%; Glume blotch fungus: 100%; Caenorhabditis elegans: 100%; Xenopus: 100%; Silk moth: 100%; Blackleg fungus: 100%; Mosquito: 100%; Channel catfish: 100%; Bovine: 100%; Aspergillus oryzae: 100%; Zebrafish: 100%; African malaria mosquito: 100%; Chicken: 100%; Aspergillus nidulans: 100%; Sartorya fumigata: 100%; Green puffer: 100%; Crab-eating macaque: 100%; Rat: 100%; blue catfish: 100%; Pyrenophora teres f. teres 0-1: 100%; Western clawed frog: 100%; Zebra finch: 100%; Atlantic salmon: 100%; Caenorhabditis briggsae: 100%; Filarial nematode worm: 100%; Pig: 100%; Mouse: 100%; Aspergillus clavatus: 100%; Northern pike: 100%; Caligus clemensi: 100%; Florida lancelet: 100%; Caenorhabditis vulgaris: 100%; Canine: 100%; Harpegnathos saltator: 100%; Camponotus floridanus: 100%; Eye worm: 100%; Red flour beetle: 100%; Perigord truffle: 100%; Aspergillus nidulans FGSC A4: 100%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P38919
• Gene Symbols: EIF4A3
• Immunogen: Synthetic peptides corresponding to DDX48 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 48) The peptide sequence was selected from the middle region of DDX48. Peptide sequence QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9775
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG