missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EIF3J Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | EIF3J |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18472132
|
Novus Biologicals
NBP2-13953-25ul |
25ul |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18038397
|
Novus Biologicals
NBP2-13953 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EIF3J Polyclonal specifically detects EIF3J in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| EIF3J | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| eIF3 p35, eIF3-alpha, eIF3j, eIF3-p35, EIF3S1eIF-3-alpha, Eukaryotic translation initiation factor 3 subunit 1, eukaryotic translation initiation factor 3 subunit J, eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD), eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa, eukaryotic translation initiation factor 3, subunit J | |
| EIF3J | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8669 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDED | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title