missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EIF3J Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Novus Biologicals NBP2-13953-25ul
Les retours ne sont pas autorisés pour ce produit.
Consulta la politica di reso
Descrizione
EIF3J Polyclonal specifically detects EIF3J in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifica
| EIF3J | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| eIF3 p35, eIF3-alpha, eIF3j, eIF3-p35, EIF3S1eIF-3-alpha, Eukaryotic translation initiation factor 3 subunit 1, eukaryotic translation initiation factor 3 subunit J, eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD), eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa, eukaryotic translation initiation factor 3, subunit J | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EIF3J | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDED | |
| 25ul | |
| Signal Transduction | |
| 8669 | |
| Human | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto