missing translation for 'onlineSavingsMsg'
Learn More
Learn More
eIF2B4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£174.00 - £366.00
Specifications
| Antigen | eIF2B4 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637510
|
Novus Biologicals
NBP2-94484-0.02ml |
0.02 mL |
£174.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18677840
|
Novus Biologicals
NBP2-94484-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
eIF2B4 Polyclonal antibody specifically detects eIF2B4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| eIF2B4 | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Endocrinology | |
| PBS (pH 7.3), 50% glycerol | |
| 8890 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DKFZp586J0119, EIF2B, EIF-2B, eIF-2B GDP-GTP exchange factor subunit delta, EIF2BD, EIF2Bdelta, eukaryotic translation initiation factor 2B, subunit 4 (delta, 67kD), eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa, translation initiation factor eIF-2b delta subunit, translation initiation factor eIF-2B subunit delta | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human eIF2B4 (Q9UI10). EMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAEL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title