missing translation for 'onlineSavingsMsg'
Learn More
Learn More
eIF2B4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94484-0.02ml
This item is not returnable.
View return policy
Description
eIF2B4 Polyclonal antibody specifically detects eIF2B4 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| eIF2B4 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 | |
| DKFZp586J0119, EIF2B, EIF-2B, eIF-2B GDP-GTP exchange factor subunit delta, EIF2BD, EIF2Bdelta, eukaryotic translation initiation factor 2B, subunit 4 (delta, 67kD), eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa, translation initiation factor eIF-2b delta subunit, translation initiation factor eIF-2B subunit delta | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 30-100 of human eIF2B4 (Q9UI10). EMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAEL | |
| 0.02 mL | |
| Endocrinology | |
| 8890 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction