missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EFCAB4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EFCAB4B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EFCAB4B Polyclonal specifically detects EFCAB4B in Human samples. It is validated for Western Blot.Specifications
| EFCAB4B | |
| Polyclonal | |
| Rabbit | |
| Q9BSW2 | |
| 84766 | |
| IgG | |
| 45 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Calcium release-activated calcium channel regulator 2A, CRAC channel regulator 2A, CRACR2A, DKFZp686G13246, EF-hand calcium binding domain 4B, EF-hand calcium-binding domain-containing protein 4B, FLJ33046, FLJ33805, MGC4266 | |
| Synthetic peptides corresponding to EFCAB4B(EF-hand calcium binding domain 4B) The peptide sequence was selected from the middle region of EFCAB4B. Peptide sequence KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title