EFCAB4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-55340

Product Code. 18266221

Description

EFCAB4B Polyclonal specifically detects EFCAB4B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: EFCAB4B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Calcium release-activated calcium channel regulator 2A, CRAC channel regulator 2A, CRACR2A, DKFZp686G13246, EF-hand calcium binding domain 4B, EF-hand calcium-binding domain-containing protein 4B, FLJ33046, FLJ33805, MGC4266
• Host Species: Rabbit
• Molecular Weight of Antigen: 45 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BSW2
• Gene Symbols: CRACR2A
• Immunogen: Synthetic peptides corresponding to EFCAB4B(EF-hand calcium binding domain 4B) The peptide sequence was selected from the middle region of EFCAB4B. Peptide sequence KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84766
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG