missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EFCAB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EFCAB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EFCAB3 Polyclonal specifically detects EFCAB3 in Human samples. It is validated for Western Blot.Specifications
| EFCAB3 | |
| Polyclonal | |
| Rabbit | |
| Q8N7B9 | |
| 146779 | |
| Synthetic peptides corresponding to EFCAB3 (EF-hand calcium binding domain 3) The peptide sequence was selected from the N terminal of EFCAB3. Peptide sequence MAVSEIKPKLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EF-hand calcium binding domain 3, EF-hand calcium-binding domain-containing protein 3, FLJ25818, MGC126801, MGC126827 | |
| EFCAB3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title