missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAAT1/GLAST-1/SLC1A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£305.00 - £435.00
Specifications
| Antigen | EAAT1/GLAST-1/SLC1A3 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18407340
|
Novus Biologicals
NBP1-84939-25ul |
25ul |
£305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18226607
|
Novus Biologicals
NBP1-84939 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EAAT1/GLAST-1/SLC1A3 Polyclonal specifically detects EAAT1/GLAST-1/SLC1A3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EAAT1/GLAST-1/SLC1A3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EA6FLJ25094, EAAT1GLAST-1, excitatory amino acid transporter 1, GLASTGLAST1, Sodium-dependent glutamate/aspartate transporter 1, solute carrier family 1 (glial high affinity glutamate transporter), member 3, Solute carrier family 1 member 3 | |
| SLC1A3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6507 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title