EAAT1/GLAST-1/SLC1A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-84939

Product Code. 18226607

Description

EAAT1/GLAST-1/SLC1A3 Polyclonal specifically detects EAAT1/GLAST-1/SLC1A3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: EAAT1/GLAST-1/SLC1A3
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: EA6FLJ25094, EAAT1GLAST-1, excitatory amino acid transporter 1, GLASTGLAST1, Sodium-dependent glutamate/aspartate transporter 1, solute carrier family 1 (glial high affinity glutamate transporter), member 3, Solute carrier family 1 member 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC1A3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETK
• Quantity: 0.1 mL
• Research Discipline: Cellular Markers
• Gene ID (Entrez): 6507
• Target Species: Human
• Isotype: IgG

For Research Use Only