missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DUSP8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | DUSP8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DUSP8 Polyclonal specifically detects DUSP8 in Human samples. It is validated for Western Blot.Specifications
| DUSP8 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Hypoxia, Signal Transduction | |
| C11orf81, chromosome 11 open reading frame 81, dual specificity phosphatase 8, Dual specificity protein phosphatase hVH-5, EC 3.1.3.16, EC 3.1.3.48, FLJ42476, FLJ42958, HVH8, serine/threonine specific protein phosphatase, vaccinia virus homolog, VH5 | |
| DUSP8 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q13202 | |
| 1850 | |
| Synthetic peptides corresponding to DUSP8(dual specificity phosphatase 8) The peptide sequence was selected from the middle region of DUSP8. Peptide sequence PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title