missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DTX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DTX2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DTX2 Polyclonal specifically detects DTX2 in Human samples. It is validated for Western Blot.Specifications
| DTX2 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| deltex (Drosophila) homolog 2, deltex homolog 2 (Drosophila), Deltex2, hDTX2, MGC71098, protein deltex-2, RING finger protein 58, RNF58KIAA1528deltex2, zinc ion binding protein | |
| DTX2 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q6XM87 | |
| 113878 | |
| Synthetic peptides corresponding to DTX2(deltex homolog 2 (Drosophila)) The peptide sequence was selected from the C terminal of DTX2. Peptide sequence EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title