DTX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-53119

Product Code. 18292751

Description

DTX2 Polyclonal specifically detects DTX2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DTX2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: deltex (Drosophila) homolog 2, deltex homolog 2 (Drosophila), Deltex2, hDTX2, MGC71098, protein deltex-2, RING finger protein 58, RNF58KIAA1528deltex2, zinc ion binding protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 84%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6XM87
• Gene Symbols: DTX2
• Immunogen: Synthetic peptides corresponding to DTX2(deltex homolog 2 (Drosophila)) The peptide sequence was selected from the C terminal of DTX2. Peptide sequence EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE.
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 113878
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.