missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DPPA5/ESG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DPPA5/ESG1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DPPA5/ESG1 Polyclonal specifically detects DPPA5/ESG1 in Human samples. It is validated for Western Blot.Specifications
| DPPA5/ESG1 | |
| Polyclonal | |
| Rabbit | |
| A6NC42 | |
| 340168 | |
| Synthetic peptides corresponding to DPPA5(developmental pluripotency associated 5) The peptide sequence was selected from the N terminal of DPPA5. Peptide sequence MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| developmental pluripotency associated 5, developmental pluripotency-associated 5 protein, embryonal stem cell specific gene 1, Embryonal stem cell-specific gene 1 protein, Esg1, ESG1ESG-1, hDPPA5 | |
| DPPA5 | |
| IgG | |
| 13 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title