missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DPPA5/ESG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-52919
This item is not returnable.
View return policy
Description
DPPA5/ESG1 Polyclonal specifically detects DPPA5/ESG1 in Human samples. It is validated for Western Blot.
Specifications
| DPPA5/ESG1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| developmental pluripotency associated 5, developmental pluripotency-associated 5 protein, embryonal stem cell specific gene 1, Embryonal stem cell-specific gene 1 protein, Esg1, ESG1ESG-1, hDPPA5 | |
| Rabbit | |
| 13 kDa | |
| 100 μL | |
| Stem Cells | |
| 340168 | |
| Human, Mouse, Rat, Pig, Canine, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| A6NC42 | |
| DPPA5 | |
| Synthetic peptides corresponding to DPPA5(developmental pluripotency associated 5) The peptide sequence was selected from the N terminal of DPPA5. Peptide sequence MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction