missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNALI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DNALI1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
DNALI1 Polyclonal specifically detects DNALI1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DNALI1 | |
| Unconjugated | |
| RUO | |
| 7802 | |
| Synthetic peptides corresponding to DNALI1(dynein, axonemal, light intermediate chain 1) The peptide sequence was selected from the N terminal of DNALI1. Peptide sequence MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| dJ423B22.5, dynein, axonemal, light intermediate chain 1, dynein, axonemal, light intermediate polypeptide 1, hp28axonemal dynein light intermediate polypeptide 1, Inner dynein arm light chain, axonemal, inner dynein arm, homolog of clamydomonas, P28dJ423B22.5 (axonemal dynein light chain (hp28)) | |
| DNALI1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title