missing translation for 'onlineSavingsMsg'
Learn More

DNAJC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£222.00 - £452.00

Specifications

Antigen	DNAJC3
Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Applications	Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18623058 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-48704-25ul	25 μL	£222.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18645688 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-48704	0.1 mL	£452.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

DNAJC3 Polyclonal antibody specifically detects DNAJC3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

Antigen	DNAJC3
Applications	Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Cellular Markers, Golgi Apparatus Markers, Lipid and Metabolism, Unfolded Protein Response
Formulation	PBS (pH 7.2), 40% Glycerol
Gene ID (Entrez)	5611
Isotype	IgG
Purification Method	Immunogen affinity purified

Dilution	Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	DnaJ (Hsp40) homolog, subfamily C, member 3, HP58, Interferon-induced, double-stranded RNA-activated protein kinase inhibitor, P58FLJ21288, P58IPKProtein kinase inhibitor p58, PRKRIdnaJ homolog subfamily C member 3, Protein kinase inhibitor of 58 kDa, protein-kinase, interferon-inducible double stranded RNA dependent inhibitor
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

DNAJC3 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents