DNA polymerase sigma Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18420282	Novus Biologicals NBP2-13728-25ul	25ul
18096138	Novus Biologicals NBP2-13728	0.1 mL

Description

DNA polymerase sigma Polyclonal antibody specifically detects DNA polymerase sigma in Human samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.

Specifications

• Antigen: DNA polymerase sigma
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: DNA polymerase kappa, DNA polymerase sigma, EC 2.7.7.7, LAK-1TUTase 5, PAP associated domain containing 7, POLKTRF41, POLSTUTASE5, polymerase (DNA directed) sigma, polymerase (DNA-directed) sigma, Terminal uridylyltransferase 5, Topoisomerase-related function protein 4-1, TRF4-1LAK1, TRF4PAP-associated domain-containing protein 7
• Gene Symbols: TENT4A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 11044
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only