missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA polymerase sigma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13728
This item is not returnable.
View return policy
Description
DNA polymerase sigma Polyclonal antibody specifically detects DNA polymerase sigma in Human samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.
Specifications
| DNA polymerase sigma | |
| Polyclonal | |
| Western Blot 0.04 to 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| DNA polymerase kappa, DNA polymerase sigma, EC 2.7.7.7, LAK-1TUTase 5, PAP associated domain containing 7, POLKTRF41, POLSTUTASE5, polymerase (DNA directed) sigma, polymerase (DNA-directed) sigma, Terminal uridylyltransferase 5, Topoisomerase-related function protein 4-1, TRF4-1LAK1, TRF4PAP-associated domain-containing protein 7 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 11044 | |
| Human, Mouse, Rat | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TENT4A | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHTRDSLPVSLSR | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction