missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA polymerase mu Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | DNA polymerase mu |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18221045
|
Novus Biologicals
NBP2-57664 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608366
|
Novus Biologicals
NBP2-57664-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNA polymerase mu Polyclonal specifically detects DNA polymerase mu in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| DNA polymerase mu | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| DNA polymerase mu, DNA-directed DNA/RNA polymerase mu, EC 2.7.7.7, FLJ35482, Pol iota, Pol Mu, polmu, polymerase (DNA directed), mu, polymerase (DNA-directed), mu, Tdt-N, Terminal transferase | |
| POLM | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 27434 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title