missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA polymerase mu Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57664-25ul
This item is not returnable.
View return policy
Description
DNA polymerase mu Polyclonal specifically detects DNA polymerase mu in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| DNA polymerase mu | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| DNA polymerase mu, DNA-directed DNA/RNA polymerase mu, EC 2.7.7.7, FLJ35482, Pol iota, Pol Mu, polmu, polymerase (DNA directed), mu, polymerase (DNA-directed), mu, Tdt-N, Terminal transferase | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| POLM | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEATHVVMEETSAEEAVSWQERRMAAAPPGCTPPALLDISWLTESLGAGQPVPVECRHRLEVAGPRKGPLSPAWMPAYACQRPTPLTHHNTG | |
| 25 μL | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| 27434 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction