missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA Polymerase gamma Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Dilution | Western Blot 1.0 ug/ml |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DNA Polymerase gamma Polyclonal specifically detects DNA Polymerase gamma in Rat samples. It is validated for Western Blot.Specifications
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Rabbit | |
| NP_445980 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| The specific Immunogen is proprietary information. Peptide sequence QDWQEQLVVGHNVSFDRAHIREQYLIQGSRMHFLDTMSMHMAISGLSSFQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title