missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DMTF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | DMTF1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DMTF1 Polyclonal specifically detects DMTF1 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| DMTF1 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer | |
| PBS buffer, 2% sucrose | |
| 9988 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| cyclin D binding myb-like transcription factor 1, cyclin D-binding Myb-like protein 1, cyclin-D-binding Myb-like transcription factor 1, Cyclin-D-interacting Myb-like protein 1, DMP1FLJ76054, FLJ25188, FLJ41265, hDMP1DMTF, hDMTF1 | |
| The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1 (EAW76962). Peptide sequence SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title