DMTF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10334-100UL

Product Code. 18362285

Description

DMTF1 Polyclonal specifically detects DMTF1 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: DMTF1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Alias: cyclin D binding myb-like transcription factor 1, cyclin D-binding Myb-like protein 1, cyclin-D-binding Myb-like transcription factor 1, Cyclin-D-interacting Myb-like protein 1, DMP1FLJ76054, FLJ25188, FLJ41265, hDMP1DMTF, hDMTF1
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1 (EAW76962). Peptide sequence SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
• Quantity: 100 μg
• Research Discipline: Breast Cancer
• Gene ID (Entrez): 9988
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified