missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DLX3 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | DLX3 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227189
|
Novus Biologicals
NBP3-33246-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229706
|
Novus Biologicals
NBP3-33246-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DLX3 Monoclonal antibody specifically detects DLX3 in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| DLX3 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Growth and Development, Neuronal Cell Markers, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 1747 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| AI4, distal-less homeo box 3, distal-less homeobox 3, homeobox protein DLX-3, TDO | |
| A synthetic peptide corresponding to a sequence within amino acids 188-287 of human DLX3 (O60479).,, Sequence:, YKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title