missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DLG7/HURP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DLG7/HURP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DLG7/HURP Polyclonal specifically detects DLG7/HURP in Human samples. It is validated for Western Blot.Specifications
| DLG7/HURP | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| DAP-5, Discs large homolog 7, discs, large (Drosophila) homolog-associated protein 5, disks large-associated protein 5, DLG7, Hepatoma up-regulated protein, HURPDLG1, KIAA0008discs, large homolog 7 (Drosophila), large homolog 7 | |
| DLGAP5 | |
| IgG | |
| 95 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q15398 | |
| 9787 | |
| Synthetic peptides corresponding to DLG7/HURP The peptide sequence was selected from the N terminal of DLG7/HURP. Peptide sequence EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title