DLG7/HURP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54640

Product Code. 18229422

Description

DLG7/HURP Polyclonal specifically detects DLG7/HURP in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DLG7/HURP
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DAP-5, Discs large homolog 7, discs, large (Drosophila) homolog-associated protein 5, disks large-associated protein 5, DLG7, Hepatoma up-regulated protein, HURPDLG1, KIAA0008discs, large homolog 7 (Drosophila), large homolog 7
• Host Species: Rabbit
• Molecular Weight of Antigen: 95 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 9787
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15398
• Gene Symbols: DLGAP5
• Immunogen: Synthetic peptides corresponding to DLG7/HURP The peptide sequence was selected from the N terminal of DLG7/HURP. Peptide sequence EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.