missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DHX38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | DHX38 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30229267
|
Novus Biologicals
NBP3-38087-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232974
|
Novus Biologicals
NBP3-38087-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DHX38 Polyclonal antibody specifically detects DHX38 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| DHX38 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| ATP-dependent RNA helicase DHX38, DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38, DEAH (Asp-Glu-Ala-His) box polypeptide 38, DEAH box protein 38, EC 3.6.1, EC 3.6.4.13, KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16, PRP16 homolog of S.cerevisiae, PRP16hPrp16, PRPF16 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2).,, Sequence:, VTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:1000 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 9785 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title