DHX38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-38087-100ul

Product Code. 30232974

Description

DHX38 Polyclonal antibody specifically detects DHX38 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: DHX38
• Classification: Polyclonal
• Dilution: Western Blot 1:1000 - 1:2000, ELISA
• Gene Alias: ATP-dependent RNA helicase DHX38, DDX38pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38, DEAH (Asp-Glu-Ala-His) box polypeptide 38, DEAH box protein 38, EC 3.6.1, EC 3.6.4.13, KIAA0224pre-mRNA splicing factor ATP-dependent RNA helicase PRP16, PRP16 homolog of S.cerevisiae, PRP16hPrp16, PRPF16
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2).,, Sequence:, VTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9785
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG