missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DHDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DHDH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DHDH Polyclonal specifically detects DHDH in Human samples. It is validated for Western Blot.Specifications
| DHDH | |
| Polyclonal | |
| Rabbit | |
| Q9UQ10 | |
| 27294 | |
| Synthetic peptides corresponding to DHDH(dihydrodiol dehydrogenase (dimeric)) The peptide sequence was selected from the middle region of DHDH. Peptide sequence PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 3-deoxyglucosone reductase, dihydrodiol dehydrogenase (dimeric), Dimeric dihydrodiol dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP dehydrogenase, EC 1.1.1.179,2DD, EC 1.3.1.20, Hum2DD, trans-1,2-dihydrobenzene-1,2-diol dehydrogenase | |
| DHDH | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title