missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DHDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-56950
This item is not returnable.
View return policy
Description
DHDH Polyclonal specifically detects DHDH in Human samples. It is validated for Western Blot.
Specifications
| DHDH | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 3-deoxyglucosone reductase, dihydrodiol dehydrogenase (dimeric), Dimeric dihydrodiol dehydrogenase, D-xylose 1-dehydrogenase, D-xylose-NADP dehydrogenase, EC 1.1.1.179,2DD, EC 1.3.1.20, Hum2DD, trans-1,2-dihydrobenzene-1,2-diol dehydrogenase | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 27294 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q9UQ10 | |
| DHDH | |
| Synthetic peptides corresponding to DHDH(dihydrodiol dehydrogenase (dimeric)) The peptide sequence was selected from the middle region of DHDH. Peptide sequence PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Pig: 84%. | |
| Human, Pig, Bovine, Canine, Equine, Yeast | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction