missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Desmocollin-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Desmocollin-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Desmocollin-3 Polyclonal specifically detects Desmocollin-3 in Human samples. It is validated for Western Blot.Specifications
| Desmocollin-3 | |
| Polyclonal | |
| Rabbit | |
| Q14574 | |
| 1825 | |
| Synthetic peptides corresponding to DSC3(desmocollin 3) The peptide sequence was selected from the N terminal of DSC3. Peptide sequence MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Cadherin family member 3, CDHF3HT-CP, desmocollin 3, desmocollin-4, DSC, DSC1, DSC2, DSC4desmocollin-3 | |
| DSC3 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title