missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEPTOR/DEPDC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £443.00
Specifications
| Antigen | DEPTOR/DEPDC6 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18440782
|
Novus Biologicals
NBP1-85255-25ul |
25ul |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18217987
|
Novus Biologicals
NBP1-85255 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DEPTOR/DEPDC6 Polyclonal specifically detects DEPTOR/DEPDC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| DEPTOR/DEPDC6 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| DEP domain containing 6, DEP domain containing mTOR interacting protein, DEP domain containing MTOR-interacting protein, DEP domain-containing mTOR-interacting protein, DEP domain-containing protein 6, DEP.6, DEPDC6FLJ12341, DKFZp564B1778, FLJ12428, FLJ13854 | |
| DEPTOR | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 64798 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title