DEPTOR/DEPDC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-85255-25ul

Product Code. 18440782

Descripción

DEPTOR/DEPDC6 Polyclonal specifically detects DEPTOR/DEPDC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Especificaciones

• Antigen: DEPTOR/DEPDC6
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DEP domain containing 6, DEP domain containing mTOR interacting protein, DEP domain containing MTOR-interacting protein, DEP domain-containing mTOR-interacting protein, DEP domain-containing protein 6, DEP.6, DEPDC6FLJ12341, DKFZp564B1778, FLJ12428, FLJ13854
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DEPTOR
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LYEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGIIQHVSNKH
• Quantity: 25ul
• Research Discipline: Cancer, Signal Transduction
• Gene ID (Entrez): 64798
• Target Species: Human
• Isotype: IgG

For Research Use Only