missing translation for 'onlineSavingsMsg'
Learn More
Learn More
delta Opioid R/OPRD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £442.00
Specifications
| Antigen | delta Opioid R/OPRD1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232667
|
Novus Biologicals
NBP3-38545-100ul |
100 μL |
£442.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228366
|
Novus Biologicals
NBP3-38545-20ul |
20 μL |
£164.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
delta Opioid R/OPRD1 Polyclonal antibody specifically detects delta Opioid R/OPRD1 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotEspecificaciones
| delta Opioid R/OPRD1 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, GPCR, Membrane Trafficking and Chaperones | |
| PBS (pH 7.3), 50% glycerol | |
| 4985 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| delta opioid receptor 1, delta-type opioid receptor, D-OR-1, DOR-1, opioid receptor, delta 1, OPRD | |
| A synthetic peptide corresponding to a sequence within amino acids 300-372 of human delta Opioid R/OPRD1 (NP_000902.3).,, Sequence:, LHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto