missing translation for 'onlineSavingsMsg'
Learn More
Learn More
delta Opioid R/OPRD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38545-20ul
This item is not returnable.
View return policy
Description
delta Opioid R/OPRD1 Polyclonal antibody specifically detects delta Opioid R/OPRD1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| delta Opioid R/OPRD1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| delta opioid receptor 1, delta-type opioid receptor, D-OR-1, DOR-1, opioid receptor, delta 1, OPRD | |
| A synthetic peptide corresponding to a sequence within amino acids 300-372 of human delta Opioid R/OPRD1 (NP_000902.3).,, Sequence:, LHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTACTPSDGPGGGAAA | |
| 20 μL | |
| Cancer, GPCR, Membrane Trafficking and Chaperones | |
| 4985 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction