missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEFB132 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | DEFB132 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18677691
|
Novus Biologicals
NBP2-92037-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18676550
|
Novus Biologicals
NBP2-92037-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DEFB132 Polyclonal antibody specifically detects DEFB132 in Mouse samples. It is validated for Western BlotSpecifications
| DEFB132 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| BD-32, beta 32, beta-defensin 32, defensin, beta 132, KFLL827, UNQ827 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DEFB132 (NP_997352.1). MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| 400830 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title