missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEFB132 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92037-0.1ml
This item is not returnable.
View return policy
Description
DEFB132 Polyclonal antibody specifically detects DEFB132 in Mouse samples. It is validated for Western Blot
Specifications
| DEFB132 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| BD-32, beta 32, beta-defensin 32, defensin, beta 132, KFLL827, UNQ827 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human DEFB132 (NP_997352.1). MKFLLLVLAALGFLTQVIPASAGGSKCVSNTPGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS | |
| 0.1 mL | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 400830 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction