missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DEFB104A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | DEFB104A |
|---|---|
| Dilution | Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18217981
|
Novus Biologicals
NBP2-59792 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18633578
|
Novus Biologicals
NBP2-59792-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DEFB104A Polyclonal specifically detects DEFB104A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| DEFB104A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 140596 | |
| This antibody was developed against a recombinant protein corresponding to the amino acid sequence:EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| DEFB104B, DEFB-4, defensin, beta 104A, defensin, beta 4 | |
| DEFB104A | |
| IgG | |
| Protein A purified |
For Research Use Only (RUO)
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title