DEFB104A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke:  Novus Biologicals NBP2-59792

Artikelnummer. 18217981

Beschreibung

DEFB104A Polyclonal specifically detects DEFB104A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: DEFB104A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: DEFB104B, DEFB-4, defensin, beta 104A, defensin, beta 4
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 140596
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DEFB104A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acid sequence:EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only (RUO)