missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DDB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | DDB1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18270394
|
Novus Biologicals
NBP2-57877 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639196
|
Novus Biologicals
NBP2-57877-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DDB1 Polyclonal specifically detects DDB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DDB1 | |
| Polyclonal | |
| Rabbit | |
| DNA Repair, Nucleotide Excision Repair | |
| damage-specific DNA binding protein 1 (127kD), damage-specific DNA binding protein 1, 127kDa, Damage-specific DNA-binding protein 1, DDB p127 subunit, DDBa, DNA damage-binding protein 1, DNA damage-binding protein a, HBV X-associated protein 1, UV-damaged DNA-binding factor, UV-damaged DNA-binding protein 1, UV-DDB 1, UV-DDB1, XAP1, XAP-1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE, XPE-BF, XPE-binding factor | |
| DDB1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 1642 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title