DDB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57877-25ul

Product Code. 18639196

Description

DDB1 Polyclonal specifically detects DDB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DDB1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: damage-specific DNA binding protein 1 (127kD), damage-specific DNA binding protein 1, 127kDa, Damage-specific DNA-binding protein 1, DDB p127 subunit, DDBa, DNA damage-binding protein 1, DNA damage-binding protein a, HBV X-associated protein 1, UV-damaged DNA-binding factor, UV-damaged DNA-binding protein 1, UV-DDB 1, UV-DDB1, XAP1, XAP-1, Xeroderma pigmentosum group E-complementing protein, XPCe, XPE, XPE-BF, XPE-binding factor
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DDB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
• Quantity: 25 μL
• Research Discipline: DNA Repair, Nucleotide Excision Repair
• Gene ID (Entrez): 1642
• Target Species: Human
• Isotype: IgG

For Research Use Only