missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCXR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £470.00
Specifications
| Antigen | DCXR |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18487771
|
Novus Biologicals
NBP1-85280 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18487271
|
Novus Biologicals
NBP1-85280-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DCXR Polyclonal antibody specifically detects DCXR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| DCXR | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cell Biology, Cytokine Research, Immunology, Innate Immunity, Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol | |
| 51181 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Carbonyl reductase II, DCR, dicarbonyl/L-xylulose reductaseP34H, EC 1.1.1, EC 1.1.1.10, HCR2, HCRII, human carbonyl reductase 2, KIDCR, Kidney dicarbonyl reductase, L-xylulose reductase, SDR20C1, short chain dehydrogenase/reductase family 20C, member 1, Sperm surface protein P34H, XR | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title