DCXR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18487771	Novus Biologicals NBP1-85280	0.1 mL
18487271	Novus Biologicals NBP1-85280-25ul	25 μL

Description

DCXR Polyclonal antibody specifically detects DCXR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: DCXR
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Apoptosis, Cell Biology, Cytokine Research, Immunology, Innate Immunity, Lipid and Metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Gene ID (Entrez): 51181
• Isotype: IgG
• Purification Method: Immunogen affinity purified

• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Carbonyl reductase II, DCR, dicarbonyl/L-xylulose reductaseP34H, EC 1.1.1, EC 1.1.1.10, HCR2, HCRII, human carbonyl reductase 2, KIDCR, Kidney dicarbonyl reductase, L-xylulose reductase, SDR20C1, short chain dehydrogenase/reductase family 20C, member 1, Sperm surface protein P34H, XR
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.