missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCXR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85280-25ul
This item is not returnable.
View return policy
Description
DCXR Polyclonal antibody specifically detects DCXR in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| DCXR | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Carbonyl reductase II, DCR, dicarbonyl/L-xylulose reductaseP34H, EC 1.1.1, EC 1.1.1.10, HCR2, HCRII, human carbonyl reductase 2, KIDCR, Kidney dicarbonyl reductase, L-xylulose reductase, SDR20C1, short chain dehydrogenase/reductase family 20C, member 1, Sperm surface protein P34H, XR | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG | |
| 25 μL | |
| Apoptosis, Cell Biology, Cytokine Research, Immunology, Innate Immunity, Lipid and Metabolism | |
| 51181 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction