missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DCAF4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | DCAF4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DCAF4 Polyclonal specifically detects DCAF4 in Human samples. It is validated for Western Blot.Specifications
| DCAF4 | |
| Polyclonal | |
| Rabbit | |
| Q8IV10 | |
| 26094 | |
| Synthetic peptides corresponding to WDR21A(WD repeat domain 21A) The peptide sequence was selected from the middle region of WDR21A. Peptide sequence GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DDB1 and CUL4 associated factor 4, DDB1- and CUL4-associated factor 4, DKFZp434K114, MGC20547, MGC46524, WD repeat domain 21, WD repeat domain 21A, WD repeat-containing protein 21A, WDR21, WDR21A | |
| DCAF4 | |
| IgG | |
| 43 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title